CacheBy
Atlas Antibodies Anti-USH1C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-USH1C Antibody

상품 한눈에 보기

Human USH1C 단백질을 인식하는 고품질 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증 완료. Rabbit IgG 기반으로 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027492-100 Anti-USH1C Antibody, Usher syndrome 1C (autosomal recessive, severe) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027492-25 Anti-USH1C Antibody, Usher syndrome 1C (autosomal recessive, severe) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-USH1C Antibody

Anti-USH1C Antibody

Target Information

  • Target Protein: Usher syndrome 1C (autosomal recessive, severe)
  • Target Gene: USH1C
  • Alternative Gene Names: AIE-75, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-73, PDZ73, PDZD7C

Product Description

Polyclonal Antibody against Human USH1C.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Applications

  • Immunohistochemistry (IHC)
  • Western Blot (WB, Orthogonal Validation)
  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM

Species Reactivity

Species Reactivity Sequence Identity
Human Verified -
Mouse Verified 86%
Rat Predicted 85%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Open Datasheet
Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.