
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-USH1C Antibody
상품 한눈에 보기
Human USH1C 단백질을 인식하는 고품질 폴리클로날 항체로, IHC, WB, ICC 등 다양한 실험에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증 완료. Rabbit IgG 기반으로 높은 특이성과 재현성을 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027492-100 Anti-USH1C Antibody, Usher syndrome 1C (autosomal recessive, severe) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027492-25 Anti-USH1C Antibody, Usher syndrome 1C (autosomal recessive, severe) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-USH1C Antibody
Anti-USH1C Antibody
Target Information
- Target Protein: Usher syndrome 1C (autosomal recessive, severe)
- Target Gene: USH1C
- Alternative Gene Names: AIE-75, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-73, PDZ73, PDZD7C
Product Description
Polyclonal Antibody against Human USH1C.
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Orthogonal Validation)
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM
Species Reactivity
| Species | Reactivity | Sequence Identity |
|---|---|---|
| Human | Verified | - |
| Mouse | Verified | 86% |
| Rat | Predicted | 85% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Open Datasheet
Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



