Thermo Fisher Scientific SRY Polyclonal Antibody
인간 SRY 단백질을 인식하는 Rabbit Polyclonal Antibody로, Western Blot에 적합합니다. 합성 펩타이드(90-130aa)를 면역원으로 사용하였으며, 항원 친화 크로마토그래피로 정제되었습니다. PBS 및 trehalose로 구성된 용액 형태로 -20°C에 보관합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific SRY Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human SRY (90–130aa: ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747186 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. It acts as the testis-determining factor (TDF), initiating male sex determination. Mutations in this gene can result in XY females with gonadal dysgenesis (Swyer syndrome), while translocation of part of the Y chromosome containing this gene to the X chromosome may cause XX male syndrome.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.