Thermo Fisher Scientific SRY Polyclonal Antibody
인간 SRY 단백질을 인식하는 Rabbit Polyclonal Antibody로, Western Blot에 적합합니다. 합성 펩타이드(90-130aa)를 면역원으로 사용하였으며, 항원 친화 크로마토그래피로 정제되었습니다. PBS 및 trehalose로 구성된 용액 형태로 -20°C에 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human SRY (90–130aa: ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747186 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This intronless gene encodes a transcription factor that is a member of the high mobility group (HMG)-box family of DNA-binding proteins. It acts as the testis-determining factor (TDF), initiating male sex determination. Mutations in this gene can result in XY females with gonadal dysgenesis (Swyer syndrome), while translocation of part of the Y chromosome containing this gene to the X chromosome may cause XX male syndrome.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific STAM Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SSR3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SRY Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SRSF1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SRSF3 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|