Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14)
SUR2A 단백질을 검출하기 위한 Thermo Fisher Scientific의 마우스 단클론 항체입니다. Western blot, IHC, ICC/IF에 적용 가능하며, 인간·마우스·랫트 반응성을 가집니다. Protein G로 정제된 액상 형태이며, 고특이적 SUR2A 검출에 적합합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14)
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 1:1,000 | View 1 publication |
| Immunohistochemistry (PFA fixed) (IHC (PFA)) | 1:100 | - |
| Immunocytochemistry (ICC/IF) | 1:100 | - |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Not Applicable |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Clone | N319A/14 |
| Immunogen | Fusion protein amino acids 1505–1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein G |
| Storage Buffer | PBS, pH 7.4, with 50% glycerol |
| Contains | 0.1% sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2735380 |
Additional Formats:
Product Specific Information
- 1 µg/mL of MA5-27637 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate by colorimetric immunoblot using goat anti-mouse IgG:HRP as secondary antibody.
- Detects approximately 120 kDa.
- Does not cross-react with SUR2B.
- Formerly sold as clone S319A-14.
Target Information
Sulfonylurea receptors (SUR) are membrane proteins that serve as molecular targets of sulfonylurea class anti-diabetic drugs, promoting insulin release from pancreatic beta cells.
SUR proteins are subunits of inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2). Four Kir6.x and four SUR subunits form the KATP channel, which regulates cellular energy balance by sensing ATP and ADP levels and modulating potassium channel activity.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Neuroligin 1 Monoclonal Antibody (N97A/31)
775,200원
Thermo Fisher Scientific
Thermo Fisher Scientific Brevican Monoclonal Antibody (N294A/6)
775,200원
Thermo Fisher Scientific
Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14)
775,200원
Thermo Fisher Scientific
Thermo Fisher Scientific SHANK2 Monoclonal Antibody (S23b-6)
849,900원
Thermo Fisher Scientific
Thermo Fisher Scientific PCLO Monoclonal Antibody (6H9-B6)
775,200원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|