원본
Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14)
상품 한눈에 보기
SUR2A 단백질을 검출하기 위한 Thermo Fisher Scientific의 마우스 단클론 항체입니다. Western blot, IHC, ICC/IF에 적용 가능하며, 인간·마우스·랫트 반응성을 가집니다. Protein G로 정제된 액상 형태이며, 고특이적 SUR2A 검출에 적합합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 02:00
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific MA527637 SUR2A Monoclonal Antibody (N319A/14) 100 ug pk판매 단위 pk ·
재고 확인 필요
775,200원VAT 포함 852,720원
Thermo Fisher Scientific · Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14)
Thermo Fisher Scientific SUR2A Monoclonal Antibody (N319A/14)
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 1:1,000 | View 1 publication |
| Immunohistochemistry (PFA fixed) (IHC (PFA)) | 1:100 | - |
| Immunocytochemistry (ICC/IF) | 1:100 | - |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Not Applicable |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Clone | N319A/14 |
| Immunogen | Fusion protein amino acids 1505–1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein G |
| Storage Buffer | PBS, pH 7.4, with 50% glycerol |
| Contains | 0.1% sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2735380 |
Additional Formats:
Product Specific Information
- 1 µg/mL of MA5-27637 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate by colorimetric immunoblot using goat anti-mouse IgG:HRP as secondary antibody.
- Detects approximately 120 kDa.
- Does not cross-react with SUR2B.
- Formerly sold as clone S319A-14.
Target Information
Sulfonylurea receptors (SUR) are membrane proteins that serve as molecular targets of sulfonylurea class anti-diabetic drugs, promoting insulin release from pancreatic beta cells.
SUR proteins are subunits of inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2). Four Kir6.x and four SUR subunits form the KATP channel, which regulates cellular energy balance by sensing ATP and ADP levels and modulating potassium channel activity.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific Neuroligin 1 Monoclonal Antibody (N97A/31)775,200원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Brevican Monoclonal Antibody (N294A/6)775,200원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific SHANK2 Monoclonal Antibody (S23b-6)849,900원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific PCLO Monoclonal Antibody (6H9-B6)775,200원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.