Atlas Antibodies Anti-UQCRC1 Antibody

상품 한눈에 보기

Human UQCRC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. Orthogonal 및 Independent validation 수행. Human, Mouse, Rat 반응성 확인. PrEST 항원을 이용한 친화 정제 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA002815-100 Anti-UQCRC1 Antibody, ubiquinol-cytochrome c reductase core protein I 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA002815-25 Anti-UQCRC1 Antibody, ubiquinol-cytochrome c reductase core protein I 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: ubiquinol-cytochrome c reductase core protein I
Supplier: Atlas Antibodies

Orthogonal validation (IHC): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직 간의 IHC 결과를 검증
Independent validation (WB): 서로 다른 epitope을 인식하는 독립 항체 간의 WB 발현 비교를 통해 검증

Type: Polyclonal Antibody
Target Species: Human UQCRC1
Alternative Gene Names: D3S3191, QCR1, UQCR1
Host: Rabbit
Isotype: IgG
Purification Method: Affinity purified using the PrEST antigen as affinity ligand
Buffer: 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Note: Gently mix before use. Optimal concentrations and conditions should be determined by the user.

항목	내용
Target Protein	ubiquinol-cytochrome c reductase core protein I
Target Gene	UQCRC1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	GDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGG
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Mouse ENSMUSG00000107235 (89%), Rat ENSRNOG00000032134 (87%)
Clonality	Polyclonal