
Atlas Antibodies Anti-UQCRC1 Antibody
상품 한눈에 보기
Human UQCRC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. Orthogonal 및 Independent validation 수행. Human, Mouse, Rat 반응성 확인. PrEST 항원을 이용한 친화 정제 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UQCRC1 Antibody
Target: ubiquinol-cytochrome c reductase core protein I
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation (IHC): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직 간의 IHC 결과를 검증
- Independent validation (WB): 서로 다른 epitope을 인식하는 독립 항체 간의 WB 발현 비교를 통해 검증
Product Description
- Type: Polyclonal Antibody
- Target Species: Human UQCRC1
- Alternative Gene Names: D3S3191, QCR1, UQCR1
- Host: Rabbit
- Isotype: IgG
- Purification Method: Affinity purified using the PrEST antigen as affinity ligand
- Buffer: 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
- Storage Note: Gently mix before use. Optimal concentrations and conditions should be determined by the user.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ubiquinol-cytochrome c reductase core protein I |
| Target Gene | UQCRC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGG |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000107235 (89%), Rat ENSRNOG00000032134 (87%) |
| Clonality | Polyclonal |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-URGCP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UQCRQ Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UQCRC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UQCRC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UQCRC2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.