CacheBy
Atlas Antibodies Anti-URGCP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-URGCP Antibody

상품 한눈에 보기

Human URGCP 단백질을 인식하는 폴리클로날 항체로, 세포 증식 조절 연구에 적합합니다. Rabbit 유래 IgG 형식이며, PrEST 항원으로 정제되었습니다. Human 반응성이 검증되었으며, IHC 등 다양한 응용에 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019879-100 Anti-URGCP Antibody, upregulator of cell proliferation 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019879-25 Anti-URGCP Antibody, upregulator of cell proliferation 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-URGCP Antibody

Anti-URGCP Antibody

Target: Upregulator of Cell Proliferation (URGCP)
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal Antibody against Human URGCP


Alternative Gene Names

DKFZp666G166, DKFZp686O0457, FLJ20654, KIAA1507, URG4

Open Datasheet


Target Information

  • Target Protein: Upregulator of Cell Proliferation
  • Target Gene: URGCP
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PSLSEKQYFLRWMEWGLARVAQPRLRQPPETLLTLRPKHGGTTDVGEPLWPEPLGVEHFLREMGQFYEAESCLVEAGRLPAGQRRFAHFP

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000012184 89%
Mouse ENSMUSG00000049680 88%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.