
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-UQCC1 Antibody
상품 한눈에 보기
Human UQCC1 단백질을 타겟으로 하는 폴리클로날 항체로, IHC 및 Western Blot에 적합합니다. Rabbit 호스트에서 생산되었으며, 높은 종간 반응성과 친화 정제 방식으로 높은 특이성을 제공합니다. 연구용으로 사용됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA034875-100 Anti-UQCC1 Antibody, ubiquinol-cytochrome c reductase complex assembly factor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034875-25 Anti-UQCC1 Antibody, ubiquinol-cytochrome c reductase complex assembly factor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UQCC1 Antibody
Anti-UQCC1 Antibody
Target: ubiquinol-cytochrome c reductase complex assembly factor 1
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human UQCC1.
Alternative Gene Names
BFZB, C20orf44, CBP3, FLJ10850, UQCC
Target Information
- Target Protein: ubiquinol-cytochrome c reductase complex assembly factor 1
- Target Gene: UQCC1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
RSGKYMCRIIVHFMWEDVQQRGRVMGVNPYILKKNMILMTNHFYAAILGYDEGILSDDHGLAAALWRTFFNRKCEDPRHLELLVEYVRKQIQYLDSMNGEDLLLTGEVSWRPLVEKNPQSILKPHSP
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Sequence Identity
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000005882 | 92% |
| Rat | ENSRNOG00000048309 | 91% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



