CacheBy
Atlas Antibodies Anti-UQCC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UQCC1 Antibody

상품 한눈에 보기

Human UQCC1 단백질을 타겟으로 하는 폴리클로날 항체로, IHC 및 Western Blot에 적합합니다. Rabbit 호스트에서 생산되었으며, 높은 종간 반응성과 친화 정제 방식으로 높은 특이성을 제공합니다. 연구용으로 사용됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034875-100 Anti-UQCC1 Antibody, ubiquinol-cytochrome c reductase complex assembly factor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034875-25 Anti-UQCC1 Antibody, ubiquinol-cytochrome c reductase complex assembly factor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UQCC1 Antibody

Anti-UQCC1 Antibody

Target: ubiquinol-cytochrome c reductase complex assembly factor 1
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human UQCC1.

Alternative Gene Names

BFZB, C20orf44, CBP3, FLJ10850, UQCC

Open Datasheet

Target Information

  • Target Protein: ubiquinol-cytochrome c reductase complex assembly factor 1
  • Target Gene: UQCC1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RSGKYMCRIIVHFMWEDVQQRGRVMGVNPYILKKNMILMTNHFYAAILGYDEGILSDDHGLAAALWRTFFNRKCEDPRHLELLVEYVRKQIQYLDSMNGEDLLLTGEVSWRPLVEKNPQSILKPHSP

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Sequence Identity

Species Gene ID Sequence Identity
Mouse ENSMUSG00000005882 92%
Rat ENSRNOG00000048309 91%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.