
Atlas Antibodies Anti-UQCC1 Antibody
상품 한눈에 보기
Human UQCC1 단백질을 타겟으로 하는 폴리클로날 항체로, IHC 및 Western Blot에 적합합니다. Rabbit 호스트에서 생산되었으며, 높은 종간 반응성과 친화 정제 방식으로 높은 특이성을 제공합니다. 연구용으로 사용됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UQCC1 Antibody
Target: ubiquinol-cytochrome c reductase complex assembly factor 1
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human UQCC1.
Alternative Gene Names
BFZB, C20orf44, CBP3, FLJ10850, UQCC
Target Information
- Target Protein: ubiquinol-cytochrome c reductase complex assembly factor 1
- Target Gene: UQCC1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
RSGKYMCRIIVHFMWEDVQQRGRVMGVNPYILKKNMILMTNHFYAAILGYDEGILSDDHGLAAALWRTFFNRKCEDPRHLELLVEYVRKQIQYLDSMNGEDLLLTGEVSWRPLVEKNPQSILKPHSP
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Sequence Identity
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000005882 | 92% |
| Rat | ENSRNOG00000048309 | 91% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-UQCC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UQCRB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UQCC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UPRT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UQCRC1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.