AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-UQCC2 Antibody
상품 한눈에 보기
Human UQCC2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합. PrEST 항원으로 친화 정제됨. 높은 종간 보존성 보유. PBS와 글리세롤 기반 완충액에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039111-100 Anti-UQCC2 Antibody, ubiquinol-cytochrome c reductase complex assembly factor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039111-25 Anti-UQCC2 Antibody, ubiquinol-cytochrome c reductase complex assembly factor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UQCC2 Antibody
Anti-UQCC2 Antibody
Target: ubiquinol-cytochrome c reductase complex assembly factor 2
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human UQCC2.
Alternative Gene Names
bA6B20.2, C6orf125, Cbp6, M19, MGC14833, MNF1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ubiquinol-cytochrome c reductase complex assembly factor 2 |
| Target Gene | UQCC2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | NYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEADDKA |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000024208 | 82% |
| Rat | ENSRNOG00000025909 | 77% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.