Atlas Antibodies Anti-UFD1 Antibody
상품 한눈에 보기
Human UFD1 단백질을 표적으로 하는 폴리클로날 항체로, ER 관련 단백질 분해 과정의 유비퀴틴 인식 인자 연구에 적합함. Rabbit 유래 IgG 항체이며, Human, Mouse, Rat에 반응. Affinity purification으로 높은 특이성과 안정성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UFD1 Antibody
Target: ubiquitin recognition factor in ER associated degradation 1 (UFD1)
Supplier: Atlas Antibodies
Recommended Applications
Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human UFD1.
Alternative Gene Names
UFD1L
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ubiquitin recognition factor in ER associated degradation 1 |
| Target Gene | UFD1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000005262 (100%) Rat ENSRNOG00000047394 (100%) |
Antigen Sequence:
MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSR
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.