
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-UFC1 Antibody
상품 한눈에 보기
Human UFC1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. Rabbit 유래 IgG 형식이며 PrEST 항원으로 친화 정제됨. Human, Mouse, Rat 반응성 확인. 안정적인 PBS/glycerol buffer로 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027481-100 Anti-UFC1 Antibody, ubiquitin-fold modifier conjugating enzyme 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027481-25 Anti-UFC1 Antibody, ubiquitin-fold modifier conjugating enzyme 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UFC1 Antibody
Anti-UFC1 Antibody
Target: ubiquitin-fold modifier conjugating enzyme 1 (UFC1)
Type: Polyclonal Antibody against Human UFC1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody targeting Human UFC1, also known as HSPC155.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ubiquitin-fold modifier conjugating enzyme 1 |
| Target Gene | UFC1 |
| Alternative Gene Names | HSPC155 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | IPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
| Mouse | Verified |
| Rat | Verified |
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000003706 (99%)
- Mouse ENSMUSG00000062963 (98%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



