Atlas Antibodies Anti-UFC1 Antibody

상품 한눈에 보기

Human UFC1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. Rabbit 유래 IgG 형식이며 PrEST 항원으로 친화 정제됨. Human, Mouse, Rat 반응성 확인. 안정적인 PBS/glycerol buffer로 보존.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027481-100 Anti-UFC1 Antibody, ubiquitin-fold modifier conjugating enzyme 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027481-25 Anti-UFC1 Antibody, ubiquitin-fold modifier conjugating enzyme 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: ubiquitin-fold modifier conjugating enzyme 1 (UFC1)
Type: Polyclonal Antibody against Human UFC1
Supplier: Atlas Antibodies

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody targeting Human UFC1, also known as HSPC155.

항목	내용
Target Protein	ubiquitin-fold modifier conjugating enzyme 1
Target Gene	UFC1
Alternative Gene Names	HSPC155
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	IPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand