Atlas Antibodies Anti-UBR5 Antibody
상품 한눈에 보기
Human UBR5 단백질을 인식하는 rabbit polyclonal 항체로, PrEST 항원을 이용해 친화 정제됨. 다양한 연구용 응용에 적합하며, 높은 종 특이성과 재현성을 제공. 40% glycerol 기반 PBS buffer에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UBR5 Antibody
Target: ubiquitin protein ligase E3 component n-recognin 5
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human UBR5, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
DD5, EDD, EDD1, HYD, KIAA0896
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ubiquitin protein ligase E3 component n-recognin 5 |
| Target Gene | UBR5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence (aa) | GSTSKEGEPNLDKKNTPVQSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLTNEKI |
Verified Species Reactivity
Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일성 |
|---|---|---|
| Mouse | ENSMUSG00000037487 | 97% |
| Rat | ENSRNOG00000006816 | 60% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Recommended Applications
Immunocytochemistry (ICC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.