
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-UBR5 Antibody
상품 한눈에 보기
Human UBR5 단백질을 인식하는 rabbit polyclonal 항체로, PrEST 항원을 이용해 친화 정제됨. 다양한 연구용 응용에 적합하며, 높은 종 특이성과 재현성을 제공. 40% glycerol 기반 PBS buffer에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053688-100 Anti-UBR5 Antibody, ubiquitin protein ligase E3 component n-recognin 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053688-25 Anti-UBR5 Antibody, ubiquitin protein ligase E3 component n-recognin 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UBR5 Antibody
Anti-UBR5 Antibody
Target: ubiquitin protein ligase E3 component n-recognin 5
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human UBR5, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
DD5, EDD, EDD1, HYD, KIAA0896
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ubiquitin protein ligase E3 component n-recognin 5 |
| Target Gene | UBR5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence (aa) | GSTSKEGEPNLDKKNTPVQSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLTNEKI |
Verified Species Reactivity
Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일성 |
|---|---|---|
| Mouse | ENSMUSG00000037487 | 97% |
| Rat | ENSRNOG00000006816 | 60% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Recommended Applications
Immunocytochemistry (ICC)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



