Atlas Antibodies Anti-UBTD1 Antibody

상품 한눈에 보기

Human UBTD1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 정제되었습니다. 높은 종간 서열 동일성(인간-쥐 98%, 인간-마우스 97%)을 보입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA034825-100 Anti-UBTD1 Antibody, ubiquitin domain containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA034825-25 Anti-UBTD1 Antibody, ubiquitin domain containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: ubiquitin domain containing 1
Supplier: Atlas Antibodies

Polyclonal antibody against Human UBTD1.

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

YQLPIYCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLT

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000013813	98%
Mouse	ENSMUSG00000025171	97%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.