CacheBy
Atlas Antibodies Anti-UBR3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UBR3 Antibody

상품 한눈에 보기

Human UBR3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 정제되었으며, 고순도의 IgG 형식입니다. 인간에 특이적으로 반응하며, Rat 및 Mouse와 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035390-100 Anti-UBR3 Antibody, ubiquitin protein ligase E3 component n-recognin 3 (putative) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035390-25 Anti-UBR3 Antibody, ubiquitin protein ligase E3 component n-recognin 3 (putative) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UBR3 Antibody

Anti-UBR3 Antibody

Target: ubiquitin protein ligase E3 component n-recognin 3 (putative)
Product Type: Polyclonal Antibody against Human UBR3


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human UBR3 (ubiquitin protein ligase E3 component n-recognin 3, putative).


Alternative Gene Names

DKFZp434P117, FLJ37422, KIAA2024, ZNF650

Open Datasheet


Target Information

항목 내용
Target Protein ubiquitin protein ligase E3 component n-recognin 3 (putative)
Target Gene UBR3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence DRSAWKHAGALKKSTCDAEKSYEVLLSFVISELFKGKLYHEEGTQECAMVNPIAWSPESMEKCLQDFCLPFLRITSLLQHHLFGEDLPSCQE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000008616 (87%)
  • Mouse ENSMUSG00000044308 (87%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.