CacheBy
Atlas Antibodies Anti-UBR2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UBR2 Antibody

상품 한눈에 보기

Human UBR2 단백질을 인식하는 Rabbit Polyclonal 항체로, E3 ubiquitin ligase 구성요소 연구에 적합함. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원을 이용해 친화 정제됨. PBS/glycerol 완충액에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027880-100 Anti-UBR2 Antibody, ubiquitin protein ligase E3 component n-recognin 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027880-25 Anti-UBR2 Antibody, ubiquitin protein ligase E3 component n-recognin 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UBR2 Antibody

Anti-UBR2 Antibody

Target: ubiquitin protein ligase E3 component n-recognin 2 (UBR2)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)

Product Description

Polyclonal Antibody against Human UBR2.

Alternative Gene Names

bA49A4.1, C6orf133, dJ392M17.3, KIAA0349

Open Datasheet

Target Information

항목 내용
Target Protein ubiquitin protein ligase E3 component n-recognin 2
Target Gene UBR2
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence QPNLTQWIRTISQQIKALQFLRKEESTPNNASTKNSENVDELQLPEGFRPDFRPKIPYSESIKEMLTTFGTATYKVGLKVHPN

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000015813 (65%)
  • Mouse ENSMUSG00000023977 (59%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.