
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TXLNB Antibody
상품 한눈에 보기
인간 TXLNB(taxilin beta)를 인식하는 폴리클로날 항체로, IHC 및 WB 검증 완료. 독립적 항체 비교 및 RNA-seq 데이터 기반 정교한 단백질 발현 검증. 친화 정제 방식으로 높은 특이성과 재현성 제공. 토끼 유래 IgG 포맷.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030403-100 Anti-TXLNB Antibody, taxilin beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030403-25 Anti-TXLNB Antibody, taxilin beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TXLNB Antibody
Anti-TXLNB Antibody
Target Information
- Target Protein: taxilin beta
- Target Gene: TXLNB
- Alternative Gene Names: C6orf198, dJ522B19.2, DKFZp451A175, MDP77
Product Description
Polyclonal antibody against human TXLNB.
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB Independent Validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PPLTPQAEAEGGSDAEPPSKASNSPAGLGAETQCEGLPVGAQADQASWKPEAEASGQAPQAPTEASLQKMEADVPAPACAAEEHVAAM
Species Reactivity
- Verified Species: Human
- Interspecies Information:
- Rat ENSRNOG00000060021 (39%)
- Mouse ENSMUSG00000021910 (38%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Material Safety Data Sheet
Open Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



