Atlas Antibodies Anti-TXLNB Antibody

상품 한눈에 보기

인간 TXLNB(taxilin beta)를 인식하는 폴리클로날 항체로, IHC 및 WB 검증 완료. 독립적 항체 비교 및 RNA-seq 데이터 기반 정교한 단백질 발현 검증. 친화 정제 방식으로 높은 특이성과 재현성 제공. 토끼 유래 IgG 포맷.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030403-100 Anti-TXLNB Antibody, taxilin beta 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030403-25 Anti-TXLNB Antibody, taxilin beta 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human TXLNB.

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Independent Validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

PPLTPQAEAEGGSDAEPPSKASNSPAGLGAETQCEGLPVGAQADQASWKPEAEASGQAPQAPTEASLQKMEADVPAPACAAEEHVAAM

Verified Species: Human
Interspecies Information:
- Rat ENSRNOG00000060021 (39%)
- Mouse ENSMUSG00000021910 (38%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.