
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TXLNB Antibody
상품 한눈에 보기
인간 TXLNB(taxilin beta)를 표적으로 하는 폴리클로날 항체입니다. IHC 및 WB에서 검증된 고품질 제품으로, orthogonal 및 independent validation을 통해 신뢰성 확보. Rabbit에서 생산되었으며, PrEST 항원을 이용한 친화 정제 방식 적용.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030401-100 Anti-TXLNB Antibody, taxilin beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030401-25 Anti-TXLNB Antibody, taxilin beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TXLNB Antibody
Anti-TXLNB Antibody
Taxilin beta
Recommended Applications
Orthogonal validation (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.Independent validation (WB)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human TXLNB
Alternative Gene Names
C6orf198, dJ522B19.2, DKFZp451A175, MDP77
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | taxilin beta |
| Target Gene | TXLNB |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PPLTPQAEAEGGSDAEPPSKASNSPAGLGAETQCEGLPVGAQADQASWKPEAEASGQAPQAPTEASLQKMEADVPAPACAAEEHVAAM |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000060021 (39%), Mouse ENSMUSG00000021910 (38%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



