CacheBy
Atlas Antibodies Anti-TXLNB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TXLNB Antibody

상품 한눈에 보기

인간 TXLNB(taxilin beta)를 표적으로 하는 폴리클로날 항체입니다. IHC 및 WB에서 검증된 고품질 제품으로, orthogonal 및 independent validation을 통해 신뢰성 확보. Rabbit에서 생산되었으며, PrEST 항원을 이용한 친화 정제 방식 적용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030401-100 Anti-TXLNB Antibody, taxilin beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030401-25 Anti-TXLNB Antibody, taxilin beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TXLNB Antibody

Anti-TXLNB Antibody

Taxilin beta


  • Orthogonal validation (IHC)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • Independent validation (WB)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human TXLNB


Alternative Gene Names

C6orf198, dJ522B19.2, DKFZp451A175, MDP77

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein taxilin beta
Target Gene TXLNB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PPLTPQAEAEGGSDAEPPSKASNSPAGLGAETQCEGLPVGAQADQASWKPEAEASGQAPQAPTEASLQKMEADVPAPACAAEEHVAAM
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000060021 (39%), Mouse ENSMUSG00000021910 (38%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Independent

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.