Atlas Antibodies Anti-TVP23B Antibody
상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA019585-100 | - | Atlas Antibodies HPA019585-100 Anti-TVP23B Antibody, trans-golgi network vesicle protein 23 homolog B (S. cerevisiae) 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
HPA019585-25 | - | Atlas Antibodies HPA019585-25 Anti-TVP23B Antibody, trans-golgi network vesicle protein 23 homolog B (S. cerevisiae) 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-TVP23B Antibody
trans-golgi network vesicle protein 23 homolog B (S. cerevisiae)
Recommended Applications
Product Description
Polyclonal Antibody against Human TVP23B
Alternative Gene Names
CGI-148, FAM18B, FAM18B1, YDR084C
Target Protein
trans-golgi network vesicle protein 23 homolog B (S. cerevisiae)
Target Gene
TVP23B
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
RCKVRSRKHLTSMATSYFGKQFLRQNTGDDQTS
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000014177 (85%)
Rat ENSRNOG00000050649 (82%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|