Atlas Antibodies Anti-TVP23C Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA065603-100 | - | Atlas Antibodies HPA065603-100 Anti-TVP23C Antibody, trans-golgi network vesicle protein 23 homolog C (S. cerevisiae) 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA065603-25 | - | Atlas Antibodies HPA065603-25 Anti-TVP23C Antibody, trans-golgi network vesicle protein 23 homolog C (S. cerevisiae) 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-TVP23C Antibody
trans-golgi network vesicle protein 23 homolog C (S. cerevisiae)
Recommended Applications
Product Description
Polyclonal Antibody against Human TVP23C
Alternative Gene Names
FAM18B2, MGC8763
Target Protein
trans-golgi network vesicle protein 23 homolog C (S. cerevisiae)
Target Gene
TVP23C
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
MLQQDSNDDTEDVSLFDAEEETTNRPRKAK
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000014177 (93%)
Rat ENSRNOG00000050649 (87%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|