Atlas Antibodies Anti-TVP23C Antibody

상품 한눈에 보기

Human TVP23C 단백질을 인식하는 토끼 폴리클로날 항체로, trans-Golgi network vesicle protein 23 homolog C를 타겟으로 함. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. Human 반응성 검증 완료.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA065603-100 Anti-TVP23C Antibody, trans-golgi network vesicle protein 23 homolog C (S. cerevisiae) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA065603-25 Anti-TVP23C Antibody, trans-golgi network vesicle protein 23 homolog C (S. cerevisiae) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TVP23C Antibody

Anti-TVP23C Antibody

Target: trans-Golgi network vesicle protein 23 homolog C (S. cerevisiae)

Recommended Applications

Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TVP23C

Alternative Gene Names

FAM18B2
MGC8763

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	trans-golgi network vesicle protein 23 homolog C (S. cerevisiae)
Target Gene	TVP23C
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (93%), Rat (87%)

Antigen Sequence:
MLQQDSNDDTEDVSLFDAEEETTNRPRKAK

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand