CacheBy
Atlas Antibodies Anti-TVP23C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TVP23C Antibody

상품 한눈에 보기

Human TVP23C 단백질을 인식하는 토끼 폴리클로날 항체로, trans-Golgi network vesicle protein 23 homolog C를 타겟으로 함. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065603-100 Anti-TVP23C Antibody, trans-golgi network vesicle protein 23 homolog C (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065603-25 Anti-TVP23C Antibody, trans-golgi network vesicle protein 23 homolog C (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TVP23C Antibody

Anti-TVP23C Antibody

Target: trans-Golgi network vesicle protein 23 homolog C (S. cerevisiae)

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TVP23C

Alternative Gene Names

  • FAM18B2
  • MGC8763

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein trans-golgi network vesicle protein 23 homolog C (S. cerevisiae)
Target Gene TVP23C
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (93%), Rat (87%)

Antigen Sequence:
MLQQDSNDDTEDVSLFDAEEETTNRPRKAK

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.