Atlas Antibodies Anti-TTC21B Antibody

상품 한눈에 보기

Human TTC21B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. PBS/glycerol buffer에 보존되어 안정적입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035494-100 Anti-TTC21B Antibody, tetratricopeptide repeat domain 21B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035494-25 Anti-TTC21B Antibody, tetratricopeptide repeat domain 21B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: tetratricopeptide repeat domain 21B (TTC21B)
Type: Polyclonal Antibody against Human TTC21B

Polyclonal antibody raised in rabbit against human TTC21B protein.
This antibody is affinity purified using the PrEST antigen as the affinity ligand.

FLJ11457, IFT139, JBTS11, NPHP12, THM1

항목	내용
Target Protein	tetratricopeptide repeat domain 21B
Target Gene	TTC21B
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	QRLLLQDSQNVEALRMQALYYVCREGDIEKASTKLENLGNALDAMEPQNAQLFYNITLAFSRTCGRSQLILQKIQTLLERAFSLNPQQSEFATELG

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet