Atlas Antibodies Anti-TTC25 Antibody

상품 한눈에 보기

Human TTC25 단백질을 인식하는 토끼 폴리클로날 항체. IHC를 통한 단백질 발현 검증에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간, 쥐, 랫드 간 교차 반응성 확인됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA023908-100 Anti-TTC25 Antibody, tetratricopeptide repeat domain 25 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA023908-25 Anti-TTC25 Antibody, tetratricopeptide repeat domain 25 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: tetratricopeptide repeat domain 25 (TTC25)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human TTC25.

항목	내용
Target Protein	Tetratricopeptide repeat domain 25
Target Gene	TTC25
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	STFPSYMAEGERLYLCGEFSKAAQSFSNALYLQDGDKNCLVARSKCFLKMGDLERSLKDAEASLQSDPAFCKGILQKAETLYTMGDFE

Species	Ortholog ID	Sequence Identity
Rat	ENSRNOG00000017473	91%
Mouse	ENSMUSG00000006784	88%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet