
Atlas Antibodies Anti-GPT Antibody
상품 한눈에 보기
Human GPT (glutamic-pyruvate transaminase) 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 WB 등 다양한 응용에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 신뢰성 높은 항체. ALT1, GPT1 유전자 타깃.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GPT Antibody
Target: glutamic-pyruvate transaminase (alanine aminotransferase)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) — Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot)
Product Description
Polyclonal antibody against Human GPT.
Alternative Gene Names
ALT1, GPT1
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | glutamic-pyruvate transaminase (alanine aminotransferase) |
| Target Gene | GPT |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFT |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000022546 (85%), Rat ENSRNOG00000033915 (85%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GRAMD1B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GPX8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GPT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRAMD1B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRAMD1A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.