CacheBy
Atlas Antibodies Anti-GPT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GPT Antibody

상품 한눈에 보기

Human GPT (glutamic-pyruvate transaminase) 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 WB 등 다양한 응용에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 신뢰성 높은 항체. ALT1, GPT1 유전자 타깃.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031059-100 Anti-GPT Antibody, glutamic-pyruvate transaminase (alanine aminotransferase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031059-25 Anti-GPT Antibody, glutamic-pyruvate transaminase (alanine aminotransferase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GPT Antibody

Anti-GPT Antibody

Target: glutamic-pyruvate transaminase (alanine aminotransferase)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) — Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human GPT.


Alternative Gene Names

ALT1, GPT1

Open Datasheet


Specifications

항목 내용
Target Protein glutamic-pyruvate transaminase (alanine aminotransferase)
Target Gene GPT
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFT
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Mouse ENSMUSG00000022546 (85%), Rat ENSRNOG00000033915 (85%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.