CacheBy
Atlas Antibodies Anti-GRAMD1B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GRAMD1B Antibody

상품 한눈에 보기

Human GRAMD1B 단백질을 인식하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. IHC 및 ICC 응용에 추천되며, PrEST 항원으로 특이적 친화 정제되었습니다. Human에 대한 검증된 반응성을 가지며 Mouse, Rat에서도 높은 서열 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA075204-100 Anti-GRAMD1B Antibody, GRAM domain containing 1B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA075204-25 Anti-GRAMD1B Antibody, GRAM domain containing 1B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GRAMD1B Antibody

Anti-GRAMD1B Antibody

Target: GRAM domain containing 1B
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human GRAMD1B.


Alternative Gene Names

  • KIAA1201

Open Datasheet


Target Information

항목 내용
Target Protein GRAM domain containing 1B
Target Gene GRAMD1B
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000040111 (93%), Rat ENSRNOG00000053577 (92%)

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

KNFWSGLEDYFRHLESELAKTESTYLAEMHRQSPKEKASKTTTVRRRKRPHAHLRVPHLEEVMSPVTTPTDEDVGHRIKHVAGSTQTRHIPEDTPNGFHLQSVSKLL

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.