Atlas Antibodies Anti-GPRC5A Antibody

상품 한눈에 보기

인간 GPRC5A 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합하며 RNA-seq 데이터 기반 정합 검증 완료. 친화 정제 방식으로 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA007928-100 Anti-GPRC5A Antibody, G protein-coupled receptor, class C, group 5, member A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA007928-25 Anti-GPRC5A Antibody, G protein-coupled receptor, class C, group 5, member A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

G protein-coupled receptor, class C, group 5, member A

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human GPRC5A

GPCR5A, RAI3, RAIG1

항목	내용
Target Protein	G protein-coupled receptor, class C, group 5, member A
Target Gene	GPRC5A
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPR
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000046733 (82%), Rat ENSRNOG00000008412 (81%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand