
Atlas Antibodies Anti-GPRC5A Antibody
상품 한눈에 보기
인간 GPRC5A 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터와의 직교 검증을 통해 높은 특이성과 신뢰성을 보장. 친화성 정제된 고품질 항체로 연구 재현성 향상.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GPRC5A Antibody
G protein-coupled receptor, class C, group 5, member A
Recommended Applications
- IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Orthogonal validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal Antibody against Human GPRC5A
Alternative Gene Names
GPCR5A, RAI3, RAIG1
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | G protein-coupled receptor, class C, group 5, member A |
| Target Gene | GPRC5A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000046733 (82%), Rat ENSRNOG00000008412 (81%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GPRASP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GPRC5A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GPRC5A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GPRIN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GPRASP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.