AI 생성

1 / 2

Atlas Antibodies Anti-GPRC5A Antibody

상품 한눈에 보기

인간 GPRC5A 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터와의 직교 검증을 통해 높은 특이성과 신뢰성을 보장. 친화성 정제된 고품질 항체로 연구 재현성 향상.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046526-100 Anti-GPRC5A Antibody, G protein-coupled receptor, class C, group 5, member A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046526-25 Anti-GPRC5A Antibody, G protein-coupled receptor, class C, group 5, member A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

G protein-coupled receptor, class C, group 5, member A

IHC (Orthogonal validation): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Orthogonal validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC: Suitable for immunocytochemistry applications.

Polyclonal Antibody against Human GPRC5A

GPCR5A, RAI3, RAIG1

항목	내용
Target Protein	G protein-coupled receptor, class C, group 5, member A
Target Gene	GPRC5A
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000046733 (82%), Rat ENSRNOG00000008412 (81%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

LTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPR

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.