Atlas Antibodies Anti-GPR182 Antibody
Human GPR182 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC Orthogonal 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성을 보장. 인간 시료에 적합하며 RNA-seq 데이터와 비교 검증된 품질.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GPR182 Antibody
G protein-coupled receptor 182 (GPR182)
Polyclonal Antibody against Human GPR182
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
- Polyclonal antibody raised in rabbit against human GPR182
- Validated for IHC with orthogonal verification
- High specificity and reproducibility through affinity purification using PrEST antigen
Alternative Gene Names
ADMR, AM-R, G10D, hrhAMR
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | G protein-coupled receptor 182 |
| Target Gene | GPR182 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS |
Verified Species Reactivity
Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 일치율 |
|---|---|---|
| Rat | ENSRNOG00000004311 | 54% |
| Mouse | ENSMUSG00000058396 | 54% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-GPR20 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-GPR19 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-GPR182 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-GPR183 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-GPR180 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|