Atlas Antibodies Anti-GPR182 Antibody

상품 한눈에 보기

Human GPR182 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC Orthogonal 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성을 보장. 인간 시료에 적합하며 RNA-seq 데이터와 비교 검증된 품질.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027037-100 Anti-GPR182 Antibody, G protein-coupled receptor 182 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027037-25 Anti-GPR182 Antibody, G protein-coupled receptor 182 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

G protein-coupled receptor 182 (GPR182)
Polyclonal Antibody against Human GPR182

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody raised in rabbit against human GPR182
Validated for IHC with orthogonal verification
High specificity and reproducibility through affinity purification using PrEST antigen

ADMR, AM-R, G10D, hrhAMR

항목	내용
Target Protein	G protein-coupled receptor 182
Target Gene	GPR182
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	LSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS