CacheBy
Atlas Antibodies Anti-GPR20 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GPR20 Antibody

상품 한눈에 보기

Human GPR20 단백질을 인식하는 Rabbit Polyclonal 항체로, PrEST 항원을 이용해 친화정제됨. 면역형광(ICC) 등 다양한 응용에 적합하며, 40% glycerol 기반 완충용액에 보존제 포함. Human에 대해 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA071337-100 Anti-GPR20 Antibody, G protein-coupled receptor 20 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071337-25 Anti-GPR20 Antibody, G protein-coupled receptor 20 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GPR20 Antibody

Anti-GPR20 Antibody

Target Information

  • Target Protein: G protein-coupled receptor 20
  • Target Gene: GPR20
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
TVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGP

Product Description

Polyclonal Antibody against Human GPR20.

Open Datasheet

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Mouse ENSMUSG00000045281 67%
Rat ENSRNOG00000013195 34%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

면역세포화학(ICC) 등 다양한 면역분석 응용에 적합합니다.

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.

제품 이미지

Recommended Application: ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.