
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GPN1 Antibody
상품 한눈에 보기
Human GPN1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 검증된 교차 반응성을 제공합니다. 다양한 종에서 보존된 GPN1 단백질 연구에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036794-100 Anti-GPN1 Antibody, GPN-loop GTPase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036794-25 Anti-GPN1 Antibody, GPN-loop GTPase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GPN1 Antibody
Anti-GPN1 Antibody
GPN-loop GTPase 1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Validation of protein expression in WB
Independent antibodies targeting different epitopes of the protein were compared to validate expression.
Product Description
Polyclonal antibody against Human GPN1 (GPN-loop GTPase 1).
Alternative Gene Names
ATPBD1A, MBDIN, NTPBP, RPAP4, XAB1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | GPN-loop GTPase 1 |
| Target Gene | GPN1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEESHEEPAFQNFMQESMAQYWKRNNK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000004941 (83%), Mouse ENSMUSG00000064037 (81%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



