Atlas Antibodies Anti-GPKOW Antibody

상품 한눈에 보기

Human GPKOW 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 독립 항체 비교를 통한 검증 완료. Rabbit 유래 IgG, PrEST 항원으로 친화 정제됨. Human, Mouse, Rat 반응성 확인. GPATC5, GPATCH5 등 다양한 유전자명 대응.

카탈로그번호: HPA001894-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA001894-100 Anti-GPKOW Antibody, G patch domain and KOW motifs 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA001894-25 Anti-GPKOW Antibody, G patch domain and KOW motifs 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GPKOW Antibody

Anti-GPKOW Antibody

제품 개요

Human GPKOW 단백질(G patch domain and KOW motifs)을 인식하는 폴리클로날 항체입니다.
IHC 및 WB에서 독립 항체 비교를 통한 단백질 발현 검증이 수행되었습니다.

권장 응용 분야

IHC (Immunohistochemistry) – 독립 항체 비교 검증 완료
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot) – 독립 항체 비교 검증 완료
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

제품 설명

Polyclonal Antibody against Human GPKOW

대체 유전자명

GPATC5, GPATCH5, Spp2, T54

Open Datasheet

항원 정보

Target Protein: G patch domain and KOW motifs
Target Gene: GPKOW
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

ELQSVKPQEAPKELVIPLIQNGHRRQPPARPPGPSTDTGALADGVVSQAVKELIAESKKSLEERENAGVDPTLAIPMIQKGCTPSGEGADSEPRAETVPEEANYEA

종간 반응성

Verified Species Reactivity: Human, Mouse, Rat
Interspecies Information:
- Rat ENSRNOG00000022939 (79%)
- Mouse ENSMUSG00000031148 (77%)

항체 특성

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand