
Atlas Antibodies Anti-GNPTG Antibody
상품 한눈에 보기
인간 GNPTG 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. 토끼 유래 IgG 항체이며 PrEST 항원으로 친화 정제됨. 인간 반응성 확인 및 마우스·랫트 교차 반응성 정보 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GNPTG Antibody
N-acetylglucosamine-1-phosphate transferase, gamma subunit
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human GNPTG
Alternative Gene Names
C16orf27, c316G12.3, CAB56184, GNPTAG
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | N-acetylglucosamine-1-phosphate transferase, gamma subunit |
| Target Gene | GNPTG |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | PHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLRTLFEDAGYLKTPEENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLG |
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000035521 | 74% |
| Rat | ENSRNOG00000024455 | 72% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GNRH2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GNRH1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GNPTG Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GNPDA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GNPTAB Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.