
원본
Atlas Antibodies Anti-GNPTAB Antibody
상품 한눈에 보기
Human GNPTAB 단백질을 인식하는 토끼 폴리클로날 항체로, N-acetylglucosamine-1-phosphate transferase α/β 서브유닛을 타깃으로 함. 면역세포화학 등 다양한 연구 응용에 적합. 고순도 Affinity 정제 및 인간 반응성 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA014558-100 Anti-GNPTAB Antibody, N-acetylglucosamine-1-phosphate transferase alpha and beta subunits 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014558-25 Anti-GNPTAB Antibody, N-acetylglucosamine-1-phosphate transferase alpha and beta subunits 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GNPTAB Antibody
Anti-GNPTAB Antibody
Target: N-acetylglucosamine-1-phosphate transferase alpha and beta subunits
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학(ICC) 등 다양한 연구 응용에 적합
Product Description
Polyclonal antibody against Human GNPTAB (N-acetylglucosamine-1-phosphate transferase alpha and beta subunits)
Alternative Gene Names
GNPTA, KIAA1208, MGC4170
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | N-acetylglucosamine-1-phosphate transferase alpha and beta subunits |
| Target Gene | GNPTAB |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | QELNKQTKKNMTIDGKELTISPAYLLWDLSAISQSKQDEDISASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNLDNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVW |
Verified Species Reactivity
Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 일치율 |
|---|---|---|
| Mouse | ENSMUSG00000035311 | 98% |
| Rat | ENSRNOG00000005228 | 95% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 직접 실험적으로 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



