
Atlas Antibodies Anti-GNPTAB Antibody
상품 한눈에 보기
Human GNPTAB 단백질을 인식하는 토끼 폴리클로날 항체로, N-acetylglucosamine-1-phosphate transferase α/β 서브유닛을 타깃으로 함. 면역세포화학 등 다양한 연구 응용에 적합. 고순도 Affinity 정제 및 인간 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GNPTAB Antibody
Target: N-acetylglucosamine-1-phosphate transferase alpha and beta subunits
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학(ICC) 등 다양한 연구 응용에 적합
Product Description
Polyclonal antibody against Human GNPTAB (N-acetylglucosamine-1-phosphate transferase alpha and beta subunits)
Alternative Gene Names
GNPTA, KIAA1208, MGC4170
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | N-acetylglucosamine-1-phosphate transferase alpha and beta subunits |
| Target Gene | GNPTAB |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | QELNKQTKKNMTIDGKELTISPAYLLWDLSAISQSKQDEDISASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNLDNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVW |
Verified Species Reactivity
Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 일치율 |
|---|---|---|
| Mouse | ENSMUSG00000035311 | 98% |
| Rat | ENSRNOG00000005228 | 95% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 직접 실험적으로 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GNPTG Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GNPDA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GNPTAB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GNPNAT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GNPDA1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.