Atlas Antibodies Anti-GNAZ Antibody

상품 한눈에 보기

Human GNAZ 단백질에 특이적인 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Recombinant Expression 검증 완료. Rabbit에서 생산된 IgG 형태이며, 프레스티지 항원으로 친화 정제됨. Human, Mouse, Rat 반응성 확인.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA003011-100 Anti-GNAZ Antibody, guanine nucleotide binding protein (G protein), alpha z polypeptide 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA003011-25 Anti-GNAZ Antibody, guanine nucleotide binding protein (G protein), alpha z polypeptide 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GNAZ Antibody

Anti-GNAZ Antibody

Target: guanine nucleotide binding protein (G protein), alpha z polypeptide
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal Validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human GNAZ
Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	guanine nucleotide binding protein (G protein), alpha z polypeptide
Target Gene	GNAZ
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence	YNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRRLWADPGAQACFSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIF
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000040009 (98%), Rat ENSRNOG00000001313 (98%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.