
Atlas Antibodies Anti-GNAZ Antibody
상품 한눈에 보기
Human GNAZ 단백질에 특이적인 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Recombinant Expression 검증 완료. Rabbit에서 생산된 IgG 형태이며, 프레스티지 항원으로 친화 정제됨. Human, Mouse, Rat 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GNAZ Antibody
Target: guanine nucleotide binding protein (G protein), alpha z polypeptide
Supplier: Atlas Antibodies
Recommended Applications
IHC (Orthogonal Validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human GNAZ
Open Datasheet (PDF)
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | guanine nucleotide binding protein (G protein), alpha z polypeptide |
| Target Gene | GNAZ |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | YNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEITPELLGVMRRLWADPGAQACFSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIF |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000040009 (98%), Rat ENSRNOG00000001313 (98%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
