CacheBy
Atlas Antibodies Anti-GNAS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GNAS Antibody

상품 한눈에 보기

Human GNAS 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 Western blot 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. PBS/glycerol buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018122-100 Anti-GNAS Antibody, GNAS complex locus 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018122-25 Anti-GNAS Antibody, GNAS complex locus 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GNAS Antibody

Anti-GNAS Antibody

Target Information

  • Target Protein: GNAS complex locus
  • Target Gene: GNAS
  • Alternative Gene Names: GNAS1, GNASXL, GPSA, NESP, NESP55, SCG6
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human GNAS.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTR

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000025889 67%
Mouse ENSMUSG00000027523 65%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.