
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GLCE Antibody
상품 한눈에 보기
인간 GLCE 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 종간 보존성을 가지며, 안정적인 PBS/글리세롤 버퍼에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA048216-100 Anti-GLCE Antibody, glucuronic acid epimerase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048216-25 Anti-GLCE Antibody, glucuronic acid epimerase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GLCE Antibody
Anti-GLCE Antibody
Target: Glucuronic acid epimerase (GLCE)
Type: Polyclonal Antibody against Human GLCE
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody is raised in rabbit against the human GLCE protein. It recognizes glucuronic acid epimerase and has been affinity purified using the PrEST antigen.
Alternative Gene Names
HSEPI, KIAA0836
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Glucuronic acid epimerase |
| Target Gene | GLCE |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVYGKVVQYDGYDR |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Mouse (ENSMUSG00000032252): 93%
- Rat (ENSRNOG00000025372): 92%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 설명 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



