CacheBy
Atlas Antibodies Anti-GLCE Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GLCE Antibody

상품 한눈에 보기

인간 GLCE 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 종간 보존성을 가지며, 안정적인 PBS/글리세롤 버퍼에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048216-100 Anti-GLCE Antibody, glucuronic acid epimerase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048216-25 Anti-GLCE Antibody, glucuronic acid epimerase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GLCE Antibody

Anti-GLCE Antibody

Target: Glucuronic acid epimerase (GLCE)
Type: Polyclonal Antibody against Human GLCE

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit against the human GLCE protein. It recognizes glucuronic acid epimerase and has been affinity purified using the PrEST antigen.

Alternative Gene Names

HSEPI, KIAA0836

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Glucuronic acid epimerase
Target Gene GLCE
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVYGKVVQYDGYDR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse (ENSMUSG00000032252): 93%
  • Rat (ENSRNOG00000025372): 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 설명
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.