CacheBy
Atlas Antibodies Anti-GLDN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GLDN Antibody

상품 한눈에 보기

Human GLDN 단백질을 표적으로 하는 rabbit polyclonal antibody로, gliomedin 단백질 검출에 적합합니다. IHC 등 다양한 응용에 사용 가능하며, PrEST 항원을 이용해 affinity purification되었습니다. Human에 대한 검증된 반응성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059441-100 Anti-GLDN Antibody, gliomedin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059441-25 Anti-GLDN Antibody, gliomedin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GLDN Antibody

Anti-GLDN Antibody

Target Information

  • Target Protein: gliomedin
  • Target Gene: GLDN
  • Alternative Gene Names: CLOM, COLM, colmedin, CRG-L2, UNC-112

Product Description

Polyclonal antibody against human GLDN.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ASAPPQDPASSARNKRSHSGEPAPHIRAESHDMLMMMTYSMVPIRVMVDLCNSTKGICLTGP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000024082 (82%)
  • Mouse ENSMUSG00000046167 (81%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
  • Immunohistochemistry (IHC)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 실험 목적에 따라 결정해야 합니다.

Reference Documents

제품 이미지

IHC Recommended Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.