
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GGA1 Antibody
상품 한눈에 보기
Human GGA1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 제조되었으며, 높은 특이성과 재현성을 제공합니다. Human에 검증되었으며 Rat, Mouse와 높은 서열 유사성을 가집니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA048280-100 Anti-GGA1 Antibody, golgi-associated, gamma adaptin ear containing, ARF binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048280-25 Anti-GGA1 Antibody, golgi-associated, gamma adaptin ear containing, ARF binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GGA1 Antibody
Anti-GGA1 Antibody
Target: golgi-associated, gamma adaptin ear containing, ARF binding protein 1
Product Type: Polyclonal Antibody against Human GGA1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
This antibody is a rabbit polyclonal antibody targeting the human GGA1 protein. It is affinity purified using the PrEST antigen as the affinity ligand to ensure high specificity and reproducibility.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | golgi-associated, gamma adaptin ear containing, ARF binding protein 1 |
| Target Gene | GGA1 |
| Antigen Sequence | PSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000008897 (84%), Mouse ENSMUSG00000033128 (83%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



