CacheBy
Atlas Antibodies Anti-GGA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GGA1 Antibody

상품 한눈에 보기

Human GGA1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 제조되었으며, 높은 특이성과 재현성을 제공합니다. Human에 검증되었으며 Rat, Mouse와 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048280-100 Anti-GGA1 Antibody, golgi-associated, gamma adaptin ear containing, ARF binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048280-25 Anti-GGA1 Antibody, golgi-associated, gamma adaptin ear containing, ARF binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GGA1 Antibody

Anti-GGA1 Antibody

Target: golgi-associated, gamma adaptin ear containing, ARF binding protein 1
Product Type: Polyclonal Antibody against Human GGA1

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

This antibody is a rabbit polyclonal antibody targeting the human GGA1 protein. It is affinity purified using the PrEST antigen as the affinity ligand to ensure high specificity and reproducibility.

Open Datasheet

Target Information

항목 내용
Target Protein golgi-associated, gamma adaptin ear containing, ARF binding protein 1
Target Gene GGA1
Antigen Sequence PSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSS
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000008897 (84%), Mouse ENSMUSG00000033128 (83%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.