CacheBy
Atlas Antibodies Anti-GGA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GGA2 Antibody

상품 한눈에 보기

인간 GGA2 단백질을 표적으로 하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. 토끼에서 생산된 IgG 형식으로 PrEST 항원 기반 친화 정제 방식 사용. 높은 특이성과 재현성을 제공하며 다양한 종에서 교차 반응성 정보 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043313-100 Anti-GGA2 Antibody, golgi-associated, gamma adaptin ear containing, ARF binding protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043313-25 Anti-GGA2 Antibody, golgi-associated, gamma adaptin ear containing, ARF binding protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GGA2 Antibody

Anti-GGA2 Antibody

Target: golgi-associated, gamma adaptin ear containing, ARF binding protein 2
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human GGA2.


Alternative Gene Names

  • KIAA1080
  • VEAR

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein golgi-associated, gamma adaptin ear containing, ARF binding protein 2
Target Gene GGA2
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000053118 (64%), Mouse ENSMUSG00000030872 (60%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ANDLLTQGVLLYKQVMEGRVTFGNRVTSSLGDIPVSRVFQNPAGCMKTCPLIDLEVDNGPAQMGTVVPSLLHQDLAALGISDAPV

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.