
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GFER Antibody
상품 한눈에 보기
Human GFER 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 응용에 적합. Rabbit 유래 IgG로 PrEST 항원을 이용해 친화 정제됨. Human 및 Rat 반응성이 검증되었으며, 간 재생 촉진인자 연구에 활용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041227-100 Anti-GFER Antibody, growth factor, augmenter of liver regeneration 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041227-25 Anti-GFER Antibody, growth factor, augmenter of liver regeneration 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GFER Antibody
Anti-GFER Antibody
Target: Growth factor, augmenter of liver regeneration
Type: Polyclonal Antibody against Human GFER
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody generated in rabbit against the human GFER protein (growth factor, augmenter of liver regeneration).
Alternative Gene Names
ALR, ERV1, HERV1, HPO1, HPO2, HSS
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Growth factor, augmenter of liver regeneration |
| Target Gene | GFER |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | QQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD |
| Verified Species Reactivity | Human, Rat |
| Interspecies Homology | Mouse (86%), Rat (85%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer and Storage
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



