Atlas Antibodies Anti-GFM1 Antibody
상품 한눈에 보기
인간 GFM1 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 및 WB에서 독립 항체 비교로 검증됨. 고순도 Affinity 정제 방식으로 제조. 인간에 대한 반응성이 확인되었으며, 마우스 및 랫과 높은 서열 유사성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GFM1 Antibody
G elongation factor, mitochondrial 1
Recommended Applications
- IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human GFM1.
Alternative Gene Names
EFGM, EGF1, GFM
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | G elongation factor, mitochondrial 1 |
| Target Gene | GFM1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SYQGELKKGDTIYNTRTRKKVRLQRLARMHADMMEDVEEVYAGDICALFGIDCASGDTFTDKANSGLSMESIHVPDPVISI |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000027774 | 89% |
| Rat | ENSRNOG00000012873 | 89% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.