CacheBy
Atlas Antibodies Anti-GFM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GFM1 Antibody

상품 한눈에 보기

인간 GFM1 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 및 WB에서 독립 항체 비교로 검증됨. 고순도 Affinity 정제 방식으로 제조. 인간에 대한 반응성이 확인되었으며, 마우스 및 랫과 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061405-100 Anti-GFM1 Antibody, G elongation factor, mitochondrial 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061405-25 Anti-GFM1 Antibody, G elongation factor, mitochondrial 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GFM1 Antibody

Anti-GFM1 Antibody

G elongation factor, mitochondrial 1


  • IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against Human GFM1.


Alternative Gene Names

EFGM, EGF1, GFM

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein G elongation factor, mitochondrial 1
Target Gene GFM1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SYQGELKKGDTIYNTRTRKKVRLQRLARMHADMMEDVEEVYAGDICALFGIDCASGDTFTDKANSGLSMESIHVPDPVISI

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity
Mouse ENSMUSG00000027774 89%
Rat ENSRNOG00000012873 89%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Validation
WB Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.