Atlas Antibodies Anti-GFM1 Antibody
Atlas Antibodies의 Anti-GFM1 항체는 인간 G elongation factor, mitochondrial 1을 인식하는 토끼 폴리클로날 IgG 항체입니다. IHC 및 WB에서 독립 항체 검증을 통해 단백질 발현을 확인합니다. PrEST 항원으로 친화 정제되었으며, 인간에 반응성이 검증되었습니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GFM1 Antibody
Target: G elongation factor, mitochondrial 1 (GFM1)
Supplier: Atlas Antibodies
Recommended Applications
IHC Independent Validation
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB Independent Validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human GFM1.
Alternative Gene Names
EFGM, EGF1, GFM
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | G elongation factor, mitochondrial 1 |
| Target Gene | GFM1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000027774 (89%), Rat ENSRNOG00000012873 (89%) |
Antigen Sequence:
SYQGELKKGDTIYNTRTRKKVRLQRLARMHADMMEDVEEVYAGDICALFGIDCASGDTFTDKANSGLSMESIHVPDPVISI
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|