AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GFM1 Antibody
상품 한눈에 보기
Atlas Antibodies의 Anti-GFM1 항체는 인간 G elongation factor, mitochondrial 1을 인식하는 토끼 폴리클로날 IgG 항체입니다. IHC 및 WB에서 독립 항체 검증을 통해 단백질 발현을 확인합니다. PrEST 항원으로 친화 정제되었으며, 인간에 반응성이 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA034765-100 Anti-GFM1 Antibody, G elongation factor, mitochondrial 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034765-25 Anti-GFM1 Antibody, G elongation factor, mitochondrial 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GFM1 Antibody
Anti-GFM1 Antibody
Target: G elongation factor, mitochondrial 1 (GFM1)
Supplier: Atlas Antibodies
Recommended Applications
IHC Independent Validation
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB Independent Validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human GFM1.
Alternative Gene Names
EFGM, EGF1, GFM
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | G elongation factor, mitochondrial 1 |
| Target Gene | GFM1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000027774 (89%), Rat ENSRNOG00000012873 (89%) |
Antigen Sequence:
SYQGELKKGDTIYNTRTRKKVRLQRLARMHADMMEDVEEVYAGDICALFGIDCASGDTFTDKANSGLSMESIHVPDPVISI
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.