
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GDI1 Antibody
상품 한눈에 보기
Human GDI1 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 종 간 보존성(인간, 쥐, 랫드 100%)을 보임. PBS/glycerol buffer에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA049290-100 Anti-GDI1 Antibody, GDP dissociation inhibitor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049290-25 Anti-GDI1 Antibody, GDP dissociation inhibitor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GDI1 Antibody
Anti-GDI1 Antibody
Target: GDP dissociation inhibitor 1 (GDI1)
Type: Polyclonal Antibody against Human GDI1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Rabbit polyclonal antibody raised against human GDI1 protein.
Affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
FLJ41411, GDIL, MRX41, MRX48, OPHN2, RABGDIA, XAP-4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | GDP dissociation inhibitor 1 |
| Target Gene | GDI1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | YRKFDLGQDVIDFTGHALALYRTDDYLDQPCLET |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000056870 (100%), Mouse ENSMUSG00000015291 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Info | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



