Atlas Antibodies Anti-GDI1 Antibody
상품 한눈에 보기
Human GDI1 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 종 간 보존성(인간, 쥐, 랫드 100%)을 보임. PBS/glycerol buffer에 보존제로 sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GDI1 Antibody
Target: GDP dissociation inhibitor 1 (GDI1)
Type: Polyclonal Antibody against Human GDI1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Rabbit polyclonal antibody raised against human GDI1 protein.
Affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
FLJ41411, GDIL, MRX41, MRX48, OPHN2, RABGDIA, XAP-4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | GDP dissociation inhibitor 1 |
| Target Gene | GDI1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | YRKFDLGQDVIDFTGHALALYRTDDYLDQPCLET |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000056870 (100%), Mouse ENSMUSG00000015291 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Info | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.