
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GDI1 Antibody
상품 한눈에 보기
인간 GDI1 단백질을 인식하는 토끼 유래 다클론 항체로, IHC 및 Western blot에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 반응성(인간, 생쥐, 랫드 100%)을 보입니다. 안정한 PBS/glycerol buffer에 보존되어 연구용으로 최적화된 제품입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA057668-100 Anti-GDI1 Antibody, GDP dissociation inhibitor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057668-25 Anti-GDI1 Antibody, GDP dissociation inhibitor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GDI1 Antibody
Anti-GDI1 Antibody
Target Protein: GDP dissociation inhibitor 1
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human GDI1.
Alternative Gene Names
FLJ41411, GDIL, MRX41, MRX48, OPHN2, RABGDIA, XAP-4
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
YRKFDLGQDVIDFTGHALALYRTDDYLDQPCLET
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000015291) – 100%
- Rat (ENSRNOG00000056870) – 100%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



