Thermo Fisher Scientific RhoF Polyclonal Antibody
RhoF 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot과 ELISA에 적합하며 Human 및 Mouse 시료에 반응. 액상 형태로 고순도 친화 크로마토그래피 정제. -20°C에서 보관.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific RhoF Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 1:500–1:2,000
ELISA
- Tested Dilution: 1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing amino acids 40–120 of human RHOF (NP_0619072) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1.32 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.01% thimerosal |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2806430 |
Product Specific Information
- Immunogen sequence: SQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHF
- Positive Samples: HT-29, 293T, Mouse kidney
- Cellular Location: Cell membrane, Cytoplasm, Cytoplasmic side, Lipid-anchor, Cytoskeleton
Target Information
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. Causes the formation of thin, actin-rich surface projections called filopodia. Functions cooperatively with CDC42 and Rac to generate additional structures, increasing the diversity of actin-based morphology.
주의사항
⚠ WARNING: This product can expose you to chemicals including mercury, which is known to the State of California to cause birth defects or other reproductive harm.
For more information, visit www.P65Warnings.ca.gov.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.