Thermo Fisher Scientific NRF1 Polyclonal Antibody
Human NRF1 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB, IHC, ICC/IF에 사용 가능. 항원 친화 크로마토그래피로 정제된 액상 형태이며, 고순도 및 안정적 보관이 가능. 연구용으로 세포 성장 및 대사 관련 유전자 연구에 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.04–0.4 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:50–1:200 |
| Immunocytochemistry (ICC/IF) | 0.25–2 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human NRF1. Recombinant protein control fragment (Product #RP-89320). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2790238 |
Product Specific Information
Immunogen sequence:
ATVATLADASELPTTVTVAQVNYSAVADGEVEQNWATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVT MALNSEAAAHAVATLAEATLQGGGQIVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTD
Target Information
This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants encoding the same protein have been characterized. Additional variants encoding different protein isoforms have been described but not fully characterized. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for nuclear factor (erythroid-derived 2)-like 1 (official symbol: NFE2L1).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific TCP-1 delta Polyclonal Antibody
862,500원
Thermo Fisher Scientific
Thermo Fisher Scientific HOXA5 Polyclonal Antibody
740,000원
Thermo Fisher Scientific
Thermo Fisher Scientific NRF1 Polyclonal Antibody
761,500원
Thermo Fisher Scientific
Thermo Fisher Scientific ITM2B Polyclonal Antibody
740,000원
Thermo Fisher Scientific
Thermo Fisher Scientific AMD1 Polyclonal Antibody
740,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|