Thermo Fisher Scientific NRF1 Polyclonal Antibody
Human NRF1 단백질을 인식하는 Rabbit Polyclonal Antibody로, WB, IHC, ICC/IF에 사용 가능. 항원 친화 크로마토그래피로 정제된 액상 형태이며, 고순도 및 안정적 보관이 가능. 연구용으로 세포 성장 및 대사 관련 유전자 연구에 적합.
- 카탈로그번호
- PA583082
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific NRF1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.04–0.4 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:50–1:200 |
| Immunocytochemistry (ICC/IF) | 0.25–2 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human NRF1. Recombinant protein control fragment (Product #RP-89320). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2790238 |
Product Specific Information
Immunogen sequence:
ATVATLADASELPTTVTVAQVNYSAVADGEVEQNWATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGATVT MALNSEAAAHAVATLAEATLQGGGQIVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTD
Target Information
This gene encodes a protein that homodimerizes and functions as a transcription factor which activates the expression of key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants encoding the same protein have been characterized. Additional variants encoding different protein isoforms have been described but not fully characterized. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene and for nuclear factor (erythroid-derived 2)-like 1 (official symbol: NFE2L1).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.