AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TRPC4AP Antibody
상품 한눈에 보기
Human TRPC4AP 단백질에 대한 고특이성 폴리클로날 항체. Rabbit 호스트에서 생산되었으며 IgG 아이소타입. Affinity purification 방식으로 정제되어 높은 순도 보장. IHC 등 다양한 응용에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA065061-100 Anti-TRPC4AP Antibody, transient receptor potential cation channel, subfamily C, member 4 associated protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065061-25 Anti-TRPC4AP Antibody, transient receptor potential cation channel, subfamily C, member 4 associated protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TRPC4AP Antibody
Anti-TRPC4AP Antibody
Target: transient receptor potential cation channel, subfamily C, member 4 associated protein (TRPC4AP)
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal Antibody against Human TRPC4AP
Alternative Gene Names
C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, PPP1R158, TRRP4AP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transient receptor potential cation channel, subfamily C, member 4 associated protein |
| Target Gene | TRPC4AP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000038324 (100%), Rat ENSRNOG00000019152 (100%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.