
Atlas Antibodies Anti-TRPC4AP Antibody
상품 한눈에 보기
Human TRPC4AP 단백질에 대한 고특이성 폴리클로날 항체. Rabbit 호스트에서 생산되었으며 IgG 아이소타입. Affinity purification 방식으로 정제되어 높은 순도 보장. IHC 등 다양한 응용에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TRPC4AP Antibody
Target: transient receptor potential cation channel, subfamily C, member 4 associated protein (TRPC4AP)
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal Antibody against Human TRPC4AP
Alternative Gene Names
C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, PPP1R158, TRRP4AP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transient receptor potential cation channel, subfamily C, member 4 associated protein |
| Target Gene | TRPC4AP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000038324 (100%), Rat ENSRNOG00000019152 (100%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TRPC7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRPC6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRPC4AP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRPC4AP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRPC1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.