CacheBy
Atlas Antibodies Anti-TRPC4AP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRPC4AP Antibody

상품 한눈에 보기

Human TRPC4AP 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 종간 반응성(쥐, 생쥐 100%)을 보유. 40% 글리세롤 및 PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051197-100 Anti-TRPC4AP Antibody, transient receptor potential cation channel, subfamily C, member 4 associated protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051197-25 Anti-TRPC4AP Antibody, transient receptor potential cation channel, subfamily C, member 4 associated protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRPC4AP Antibody

Anti-TRPC4AP Antibody

Target: transient receptor potential cation channel, subfamily C, member 4 associated protein (TRPC4AP)
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal antibody against human TRPC4AP.


Alternative Gene Names

C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, PPP1R158, TRRP4AP

Open Datasheet


Target Information

항목 내용
Target Protein transient receptor potential cation channel, subfamily C, member 4 associated protein
Target Gene TRPC4AP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000019152): 100%
  • Mouse (ENSMUSG00000038324): 100%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.