
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TRPC4AP Antibody
상품 한눈에 보기
Human TRPC4AP 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 종간 반응성(쥐, 생쥐 100%)을 보유. 40% 글리세롤 및 PBS 완충액에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA051197-100 Anti-TRPC4AP Antibody, transient receptor potential cation channel, subfamily C, member 4 associated protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051197-25 Anti-TRPC4AP Antibody, transient receptor potential cation channel, subfamily C, member 4 associated protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TRPC4AP Antibody
Anti-TRPC4AP Antibody
Target: transient receptor potential cation channel, subfamily C, member 4 associated protein (TRPC4AP)
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal antibody against human TRPC4AP.
Alternative Gene Names
C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, PPP1R158, TRRP4AP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transient receptor potential cation channel, subfamily C, member 4 associated protein |
| Target Gene | TRPC4AP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGK |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000019152): 100%
- Mouse (ENSMUSG00000038324): 100%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



