
Atlas Antibodies Anti-TRIM55 Antibody
상품 한눈에 보기
Human TRIM55 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. MURF-2, RNF29 등의 대체 유전자명으로 알려진 TRIM55를 타겟으로 함. 높은 특이성과 친화도로 정제된 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TRIM55 Antibody
Target Information
- Target Protein: Tripartite motif containing 55
- Target Gene: TRIM55
- Alternative Gene Names: MURF-2, RNF29
Product Description
Polyclonal antibody against human TRIM55.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
GLGQIGPPGSEDSNVRKAEVAAAAASERAAVSGKETSAPAATSQIGFEAPPLQGQAAAPASGSGADSEPARHIFSFSWLNSLNE
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000012723): 76%
- Mouse (ENSMUSG00000060913): 76%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Recommended Applications
Immunohistochemistry (IHC)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Reference Documents
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TRIM56 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM55 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM55 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM52 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM54 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.