
Atlas Antibodies Anti-TRIM52 Antibody
상품 한눈에 보기
Human TRIM52 단백질을 인식하는 토끼 폴리클로날 항체로, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, RNF102로도 알려진 TRIM52 연구에 활용 가능. 글리세롤/PBS 완충액에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TRIM52 Antibody
Target Information
- Target Protein: tripartite motif containing 52
- Target Gene: TRIM52
- Alternative Gene Names: RNF102
Product Description
Polyclonal antibody against human TRIM52 (tripartite motif containing 52).
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence used for immunization.
Antigen Sequence:
EDEEAVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEE
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000040365 (45%)
- Rat ENSRNOG00000002388 (43%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Recommended Applications | ICC (Immunocytochemistry) |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (MSDS)
Open Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TRIM55 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM55 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM52 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM54 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM52 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.