Atlas Antibodies Anti-TRIM52 Antibody

상품 한눈에 보기

Human TRIM52 단백질을 인식하는 토끼 폴리클로날 항체로, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, RNF102로도 알려진 TRIM52 연구에 활용 가능. 글리세롤/PBS 완충액에 보존됨.

카탈로그번호: HPA056819-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA056819-100 Anti-TRIM52 Antibody, tripartite motif containing 52 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA056819-25 Anti-TRIM52 Antibody, tripartite motif containing 52 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-TRIM52 Antibody

Anti-TRIM52 Antibody

Target Information

Target Protein: tripartite motif containing 52
Target Gene: TRIM52
Alternative Gene Names: RNF102

Product Description

Polyclonal antibody against human TRIM52 (tripartite motif containing 52).
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence used for immunization.

Antigen Sequence:
EDEEAVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEE

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000040365 (45%)
Rat ENSRNOG00000002388 (43%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications	ICC (Immunocytochemistry)
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.