Atlas Antibodies Anti-TREML1 Antibody
상품 한눈에 보기
Human TREML1 단백질을 인식하는 폴리클로날 항체로, IHC 기반 단백질 발현 검증에 적합. Rabbit 유래 IgG 항체이며 PrEST 항원을 이용해 친화 정제됨. 인체 특이 반응성과 높은 품질의 orthogonal validation 데이터 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TREML1 Antibody
Target: Triggering receptor expressed on myeloid cells-like 1 (TREML1)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human TREML1.
Alternative Gene Names
dJ238O23.3, TLT1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Triggering receptor expressed on myeloid cells-like 1 |
| Target Gene | TREML1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KRKQGNRLGVCGRFLSSRVSGMNPSSVVHHVSDSGPAAELPLDVPHIRLDSPPSFDNTTYTSLPLDSPSGKPSLPAPSSLPPLPPKVLVCSKPVTYATVIFPGGNKGGGTSCGPAQNPPNNQTPSS |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000040109 | 63% |
| Mouse | ENSMUSG00000023993 | 62% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-TREML4 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-TREML1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-TREML1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-TREM1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-TREH Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.