CacheBy
Atlas Antibodies Anti-TREH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TREH Antibody

상품 한눈에 보기

Human TREH 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 포함한 단백질 발현 분석에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와의 일관성을 확인하였으며, PrEST 항원으로 친화 정제되었습니다. Human에 특이적으로 반응합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042045-100 Anti-TREH Antibody, trehalase (brush-border membrane glycoprotein) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042045-25 Anti-TREH Antibody, trehalase (brush-border membrane glycoprotein) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TREH Antibody

Anti-TREH Antibody

Target: trehalase (brush-border membrane glycoprotein)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human TREH

Alternative Gene Names

MGC129621, TRE, TREA

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein trehalase (brush-border membrane glycoprotein)
Target Gene TREH
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LYQDDKQFVDMPLSIAPEQVLQTFTELSRDHNHSIPREQLQAFVHEHFQAKGQELQPWTPADWKDSPQFLQKISDAKLRAWAGQLHQLWKKLGKK
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000032098 (74%), Rat ENSRNOG00000052010 (73%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.