Atlas Antibodies Anti-TRAK1 Antibody
Human TRAK1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 제조됨. IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. Human 반응성 검증 완료. 안정적 PBS/glycerol buffer에 보존.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TRAK1 Antibody
제품 개요
- Target Protein: trafficking protein, kinesin binding 1
- Target Gene: TRAK1
- Alternative Gene Names: KIAA1042, MILT1, OIP106
- Clonality: Polyclonal
- Isotype: IgG
- Host: Rabbit
- Verified Species Reactivity: Human
- Recommended Applications: Immunohistochemistry (IHC)
제품 설명
Polyclonal antibody against Human TRAK1.
Affinity purified using the PrEST antigen as affinity ligand.
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
ELEDKYAECMEMLHEAQEELKNLRNKTMPNTTSRRYHSLGLFPMDSLAAEIEGTMRKELQLEEAESPDITHQKRVFETVRNINQVVKQRSLTPSPMNIPGSNQSSAMNSLLSSCVSTPRSSFYGSDIGNVVLDNKTNSIILET
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000032536 (95%)
- Rat ENSRNOG00000019262 (94%)
Buffer 구성
| 구성 성분 | 설명 |
|---|---|
| PBS (pH 7.2) | 기본 buffer |
| Glycerol | 40% 함유 |
| Sodium Azide | 0.02% (preservative) |
참고 자료
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-TRAK1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-TRAK2 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-TRAK1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-TRAIP Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-TRAFD1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|