CacheBy
Atlas Antibodies Anti-TRAFD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TRAFD1 Antibody

상품 한눈에 보기

Human TRAFD1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal 및 recombinant expression validation을 통해 검증되었습니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039254-100 Anti-TRAFD1 Antibody, TRAF-type zinc finger domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039254-25 Anti-TRAFD1 Antibody, TRAF-type zinc finger domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TRAFD1 Antibody

Anti-TRAFD1 Antibody

Target Information

  • Protein Name: TRAF-type zinc finger domain containing 1
  • Gene Name: TRAFD1
  • Alternative Gene Names: FLN29
  • IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant Expression): Validation using target protein overexpression.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal Antibody against Human TRAFD1

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    PSSPCVPKLSNSDSQDIQGRNRDSQNGAIAPGHVSVIRPPQNLYPENIVPSFSPGPSGRYGASGRSEGGRNSRVTPAAANYRSRTAKAKPSKQQGAGD

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000042726 70%
Rat ENSRNOG00000001351 67%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Safety Information Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Recombinant Expression
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.